PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G20060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 233aa    MW: 24709.6 Da    PI: 6.514
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G20060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv +++++G+g+W++++ + g+ R+ k+c++rw +yl
  LPERR07G20060.1 14 KGPWTPEEDLVLVSYIQEHGPGNWRAVPTRTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding521.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  LPERR07G20060.1  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.254961IPR017930Myb domain
SuperFamilySSF466895.99E-3011108IPR009057Homeodomain-like
SMARTSM007175.3E-131363IPR001005SANT/Myb domain
PfamPF002493.9E-161461IPR001005SANT/Myb domain
CDDcd001674.09E-111661No hitNo description
PROSITE profilePS5129424.90362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PfamPF002493.3E-1567112IPR001005SANT/Myb domain
CDDcd001671.12E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MVRPPCCDKD GVKKGPWTPE EDLVLVSYIQ EHGPGNWRAV PTRTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKRKLHSSA  120
SASASAGYVL TTENISRMLD GWARKGGGGG GGPATPGGAE SASGSSEASE VSYGGGVGAT  180
PAAAFEYETK PAVAGGGGGG DETQLSAIES WLFADVDAVA SGSLLDAAMD YPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-27141164105MYB PROTO-ONCOGENE PROTEIN
1msf_C4e-27141164105C-Myb DNA-Binding Domain
1mse_C4e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1016741e-116AK101674.1 Oryza sativa Japonica Group cDNA clone:J033058E05, full insert sequence.
GenBankAY3234801e-116AY323480.1 Oryza sativa (japonica cultivar-group) putative myb protein (MYB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658859.11e-127PREDICTED: transcription factor MYB30-like
SwissprotQ9SCU73e-80MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0D9X1T21e-172A0A0D9X1T2_9ORYZ; Uncharacterized protein
STRINGGSMUA_Achr7P21010_0014e-91(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-80myb domain protein 60